PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03628.1.g00070.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 403aa    MW: 42161.3 Da    PI: 9.3593
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03628.1.g00070.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.4e-32235291258
                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                                   +Dgy+WrKYGqK vk+s+fprsY+rCt ++C+vkk+vers+edp+vv++tYeg+H h
  Zpz_sc03628.1.g00070.1.am.mk 235 EDGYRWRKYGQKAVKNSPFPRSYFRCTNSKCTVKKRVERSSEDPSVVITTYEGQHCH 291
                                   8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.2E-33219292IPR003657WRKY domain
SuperFamilySSF1182901.31E-27226292IPR003657WRKY domain
PROSITE profilePS5081129.207229294IPR003657WRKY domain
SMARTSM007744.8E-38234293IPR003657WRKY domain
PfamPF031062.4E-25235291IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MAGAAGYGPQ GAGEDWPFAG AVDAFADYSS VLTELGWPGG LAADLSVLDL PEATRLAPEL  60
ARPEEIVAAP AMSGDAAGAS SSSSGDGPGH GAARGNGDQK PADEAVAAVR HTALRAPRLR  120
LAGRYADPAR AASIGSRAAI CVRGLDGSSF SMQLRRTFLA DPHVNSSVGG ERHLVGWWGC  180
GHGGPSLDRP TNFFVSPTFA KRVAVKPAAP AKKGPKRARQ PRFAFMTKSE IDHLEDGYRW  240
RKYGQKAVKN SPFPRSYFRC TNSKCTVKKR VERSSEDPSV VITTYEGQHC HYTAAAAAFQ  300
SGAGPASAHR IHSAAAAVAL AEQMPFVAAA QRRLSPFHPQ SSPPSCSETA VDVTAALASS  360
LQQYLSGSER VSMPSTPSSV AQAPASVEKG LLDDIVPHGV RHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-25224291774Probable WRKY transcription factor 4
1wj2_A5e-25224291774Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU0586084e-92KU058608.1 UNVERIFIED: Panicum miliaceum WRKY8-like gene, complete sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-42WRKY DNA-binding protein 57